PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00754.1_g00013.1
Common NameCOL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 307aa    MW: 33134.2 Da    PI: 7.0319
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00754.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.14.1e-09447441
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                             r C+ + +  ++l+C+ +  +lC +C  ++H        H++v 
  Rsa1.0_00754.1_g00013.1  4 RLCDSCRSAAATLYCRADAAFLCGECDGKIHTAnklasrHERVL 47
                             68*****************************5577888888775 PP

2zf-B_box26.71.1e-084791442
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               C+ +e+ +++  Ce +   lC +C   +H+       H++vp+
  Rsa1.0_00754.1_g00013.1 47 LLCQVCEQAPAHVTCEADAAALCVTCDRDIHSAnplsrrHERVPV 91
                             68*****************************66899999*99986 PP

3CCT68.81.4e-23241284144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  Rsa1.0_00754.1_g00013.1 241 REARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRT 284
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.708148IPR000315B-box-type zinc finger
SMARTSM003367.0E-16148IPR000315B-box-type zinc finger
PfamPF006432.9E-7446IPR000315B-box-type zinc finger
CDDcd000216.47E-9448No hitNo description
PROSITE profilePS5011911.1354491IPR000315B-box-type zinc finger
PfamPF006437.6E-74791IPR000315B-box-type zinc finger
CDDcd000213.54E-94891No hitNo description
SMARTSM003366.2E-114991IPR000315B-box-type zinc finger
PfamPF062032.1E-17241283IPR010402CCT domain
PROSITE profilePS5101716.618241283IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MASRLCDSCR SAAATLYCRA DAAFLCGECD GKIHTANKLA SRHERVLLCQ VCEQAPAHVT  60
CEADAAALCV TCDRDIHSAN PLSRRHERVP VTPFYDAPAQ GGSPATTKSA ASSNLFGEDA  120
DVSMEAVSWL LPNPSVKEGV VVEIPNLFAD LDYSAVDPKM EASENSSGND GVVPVQTKAL  180
FLNEDYFNFD VSASKTTFPH GYSCINQTVS STSLEVPLVP EGGAVTTTNA TPAVQLSPAE  240
REARVLRYRE KRKNRKFEKT IRYASRKAYA EVRPRIKGRF AKRTDSRVND GGGDVGVYGG  300
FGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0526900.0AF052690.1 Raphanus sativus CONSTANS-like 1 protein (COL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631409.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
RefseqXP_013687100.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
SwissprotQ9SK531e-146COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLO824310.0O82431_RAPSA; CONSTANS-like 1 protein
STRINGBra032061.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-146CONSTANS-like 3
Publications ? help Back to Top
  1. Moon YH,Chae S,Jung JY,An G
    Expressed sequence tags of radish flower buds and characterization of a CONSTANS LIKE 1 gene.
    Mol. Cells, 1998. 8(4): p. 452-8
    [PMID:9749533]